MMP13 Polyclonal AntibodyMMP13 Polyclonal Antibody
Move your mouse over image or click to enlarge

MMP13 Polyclonal Antibody

Cat# Size Price Qty Buy
A1606-20ul 20ul
£77.00
A1606-50ul 50ul
£113.75
A1606-100ul 100ul
£192.50
A1606-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A1606
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MMP13; CLG3; MANDP1; MDST; MMP-13; collagenase 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 262-471 of human MMP13 (NP_002418.1).
Reactivity Human, Mouse
Gene ID 4322
Calculated MW 53kDa
Observed MW 60kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 28647469
Sequence IQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents