MKL2 Polyclonal AntibodyMKL2 Polyclonal Antibody
Move your mouse over image or click to enlarge

MKL2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13113-200ul 200ul
£332.50
A13113-100ul 100ul
£192.50
A13113-50ul 50ul
£113.75
A13113-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13113
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MKL2; MRTF-B; MRTFB; NPD001; MKL1/myocardin like 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 170-300 of human MKL2 (NP_054767.3).
Reactivity Human, Mouse
Gene ID 57496
Calculated MW 42kDa/51kDa/114kDa/118kDa/119kDa
Observed MW 145kDa
Physical Appearance liquid
Purification Affinity purification
Sequence IIGVGKEDYPHTQGDFSFDEDSSDALSPDQPASQESQGSAASPSEPKVSESPSPVTTNTPAQFASVSPTVPEFLKTPPTADQPPPRPAAPVLPTNTVSSAKPGPALVKQSHPKNPNDKHRSKKCKDPKPRV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents