MIF Polyclonal AntibodyMIF Polyclonal Antibody
Move your mouse over image or click to enlarge

MIF Polyclonal Antibody

Cat# Size Price Qty Buy
A1391-200ul 200ul
£332.50
A1391-100ul 100ul
£192.50
A1391-50ul 50ul
£113.75
A1391-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A1391
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MIF; GIF; GLIF; MMIF; macrophage migration inhibitory factor
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human MIF (NP_002406.1).
Reactivity Human, Mouse, Rat
Gene ID 4282
Calculated MW 12kDa
Observed MW 12kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 26884823
Sequence MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Sensitivity WB,1:500 - 1:2000|IF,1:10 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents