MGAT5B Polyclonal AntibodyMGAT5B Polyclonal Antibody
Move your mouse over image or click to enlarge

MGAT5B Polyclonal Antibody

Cat# Size Price Qty Buy
A13870-200ul 200ul
£332.50
A13870-100ul 100ul
£192.50
A13870-50ul 50ul
£113.75
A13870-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13870
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MGAT5B; GnT-IX; GnT-VB; alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 616-790 of human MGAT5B (NP_653278.2).
Reactivity Mouse
Gene ID 146664
Calculated MW 89kDa/90kDa
Observed MW 89kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DPYLPYEYTCEGMLERIHAYIQHQDFCRAPDPALPEAHAPQSPFVLAPNATHLEWARNTSLAPGAWPPAHALRAWLAVPGRACTDTCLDHGLICEPSFFPFLNSQDAFLKLQVPCDSTESEMNHLYPAFAQPGQECYLQKEPLLFSCAGSNTKYRRLCPCRDFRKGQVALCQGCL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents