MESDC2 Polyclonal AntibodyMESDC2 Polyclonal Antibody
Move your mouse over image or click to enlarge

MESDC2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13931-200ul 200ul
£332.50
A13931-100ul 100ul
£192.50
A13931-50ul 50ul
£113.75
A13931-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13931
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MESDC2; BOCA; MESD; LDLR chaperone MESD
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-234 of human MESDC2 (NP_055969.1).
Reactivity Human, Mouse
Gene ID 23184
Calculated MW 26kDa
Observed MW 26kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAASRWARKAVVLLCASDLLLLLLLLPPPGSCAAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNKREDL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents