MED18 Polyclonal AntibodyMED18 Polyclonal Antibody
Move your mouse over image or click to enlarge

MED18 Polyclonal Antibody

Cat# Size Price Qty Buy
A14588-200ul 200ul
£332.50
A14588-100ul 100ul
£192.50
A14588-50ul 50ul
£113.75
A14588-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14588
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MED18; p28b; SRB5; mediator complex subunit 18
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-110 of human MED18 (NP_060108.2).
Reactivity Human
Gene ID 54797
Calculated MW 23kDa
Observed MW 24kDa
Physical Appearance liquid
Purification Affinity purification
Sequence HSLESLIHRLRGLCDNMEPETFLDHEMVFLLKGQQASPFVLRARRSMDRAGAPWHLRYLGQPEMGDKNRHALVRNCVDIAT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents