MECOM Polyclonal AntibodyMECOM Polyclonal Antibody
Move your mouse over image or click to enlarge

MECOM Polyclonal Antibody

Cat# Size Price Qty Buy
A13669-200ul 200ul
£332.50
A13669-100ul 100ul
£192.50
A13669-50ul 50ul
£113.75
A13669-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13669
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MECOM; AML1-EVI-1; EVI1; KMT8E; MDS1; MDS1-EVI1; PRDM3; RUSAT2; MDS1 and EVI1 complex locus
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human MECOM (NP_004982.2).
Reactivity Human, Mouse
Gene ID 2122
Calculated MW 18kDa/117kDa/118kDa/125kDa/139kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPKEGSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDP
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents