MC1R Polyclonal AntibodyMC1R Polyclonal Antibody
Move your mouse over image or click to enlarge

MC1R Polyclonal Antibody

Cat# Size Price Qty Buy
A13152-200ul 200ul
£332.50
A13152-100ul 100ul
£192.50
A13152-50ul 50ul
£113.75
A13152-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13152
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MC1R; CMM5; MSH-R; SHEP2; melanocortin 1 receptor
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human MC1R (NP_002377.4).
Reactivity Human, Mouse, Rat
Gene ID 4157
Calculated MW 34kDa
Observed MW 36kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGAVTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAFHSQELRRTLKEVLTCSW
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents