MARCH6 Polyclonal AntibodyMARCH6 Polyclonal Antibody
Move your mouse over image or click to enlarge

MARCH6 Polyclonal Antibody

Cat# Size Price Qty Buy
A16097-20ul 20ul
£77.00
A16097-50ul 50ul
£113.75
A16097-100ul 100ul
£192.50
A16097-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16097
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MARCH6; DOA10; MARCH-VI; RNF176; TEB4; E3 ubiquitin-protein ligase MARCH6
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 10-80 of human MARCH6 (NP_005876.2).
Reactivity Human
Gene ID 10299
Calculated MW 90kDa/97kDa/102kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence RVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMPSRLPIQDIFA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents