MAP4K3 Polyclonal AntibodyMAP4K3 Polyclonal Antibody
Move your mouse over image or click to enlarge

MAP4K3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13375-200ul 200ul
£332.50
A13375-100ul 100ul
£192.50
A13375-50ul 50ul
£113.75
A13375-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13375
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MAP4K3; GLK; MAPKKKK3; MEKKK 3; MEKKK3; RAB8IPL1; mitogen-activated protein kinase kinase kinase kinase 3
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 755-894 of human MAP4K3 (NP_003609.2).
Reactivity Human
Gene ID 8491
Calculated MW 98kDa/100kDa/101kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ETVNPNSTSSWFTESDTPQTNVTHVTQLERDTILVCLDCCIKIVNLQGRLKSSRKLSSELTFDFQIESIVCLQDSVLAFWKHGMQGRSFRSNEVTQEISDSTRIFRLLGSDRVVVLESRPTDNPTANSNLYILAGHENSY
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents