MAP2K6 Polyclonal AntibodyMAP2K6 Polyclonal Antibody
Move your mouse over image or click to enlarge

MAP2K6 Polyclonal Antibody

Cat# Size Price Qty Buy
A14191-200ul 200ul
£332.50
A14191-100ul 100ul
£192.50
A14191-50ul 50ul
£113.75
A14191-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14191
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MAP2K6; MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3; mitogen-activated protein kinase kinase 6
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-334 of human MAP2K6 (NP_002749.2).
Reactivity Human, Mouse, Rat
Gene ID 5608
Calculated MW 31kDa/37kDa
Observed MW 37kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents