MAN1A2 Polyclonal AntibodyMAN1A2 Polyclonal Antibody
Move your mouse over image or click to enlarge

MAN1A2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14271-200ul 200ul
£332.50
A14271-100ul 100ul
£192.50
A14271-50ul 50ul
£113.75
A14271-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14271
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MAN1A2; MAN1B; mannosidase alpha class 1A member 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human MAN1A2 (NP_006690.1).
Reactivity Human, Mouse
Gene ID 10905
Calculated MW 73kDa
Observed MW 73kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SSKHKRFDLGLEDVLIPHVDAGKGAKNPGVFLIHGPDEHRHREEEERLRNKIRADHEKALEEAKEKLRKSREEIRAEIQTEKNKVVQEMKIKENKPLPPVPIPNLVGIRGGDPEDNDIREK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents