LYZL1 Polyclonal AntibodyLYZL1 Polyclonal Antibody
Move your mouse over image or click to enlarge

LYZL1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13823-200ul 200ul
£332.50
A13823-100ul 100ul
£192.50
A13823-50ul 50ul
£113.75
A13823-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13823
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names LYZL1; KAAG648; LYC2; LYZD1; PRO1278; bA534G20.1; lysozyme like 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-194 of human LYZL1 (NP_115906.3).
Reactivity Rat
Gene ID 84569
Calculated MW 16kDa/21kDa
Observed MW 17kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MQDAPLSCLSPTKWSSVSSADSTEKSASGAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents