LSM3 Polyclonal AntibodyLSM3 Polyclonal Antibody
Move your mouse over image or click to enlarge

LSM3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13189-200ul 200ul
£332.50
A13189-100ul 100ul
£192.50
A13189-50ul 50ul
£113.75
A13189-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13189
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names LSM3; SMX4; USS2; YLR438C; U6 snRNA-associated Sm-like protein LSm3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human LSM3 (NP_055278.1).
Reactivity Human, Mouse
Gene ID 27258
Calculated MW 11kDa
Observed MW 12kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents