LRP6 Polyclonal AntibodyLRP6 Polyclonal Antibody
Move your mouse over image or click to enlarge

LRP6 Polyclonal Antibody

Cat# Size Price Qty Buy
A13678-200ul 200ul
£332.50
A13678-100ul 100ul
£192.50
A13678-50ul 50ul
£113.75
A13678-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13678
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names LRP6; ADCAD2; STHAG7; LDL receptor related protein 6
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1350-1450 of human LRP6 (NP_002327.2).
Reactivity Human, Mouse, Rat
Gene ID 4040
Calculated MW 180kDa
Observed MW 200kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTVYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents