LRAT Polyclonal AntibodyLRAT Polyclonal Antibody
Move your mouse over image or click to enlarge

LRAT Polyclonal Antibody

Cat# Size Price Qty Buy
A13175-200ul 200ul
£332.50
A13175-100ul 100ul
£192.50
A13175-50ul 50ul
£113.75
A13175-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13175
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names LRAT; LCA14; lecithin retinol acyltransferase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 31-150 of human LRAT (NP_004735.2).
Reactivity Human, Rat
Gene ID 9227
Calculated MW 25kDa
Observed MW 50-54kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GEDKGRNSFYETSSFHRGDVLEVPRTHLTHYGIYLGDNRVAHMMPDILLALTDDMGRTQKVVSNKRLILGVIVKVASIRVDTVEDFAYGANILVNHLDESLQKKALLNEEVARRAEKLLG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents