LONRF1 Polyclonal AntibodyLONRF1 Polyclonal Antibody
Move your mouse over image or click to enlarge

LONRF1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14433-200ul 200ul
£332.50
A14433-100ul 100ul
£192.50
A14433-50ul 50ul
£113.75
A14433-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14433
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names LONRF1; RNF191; LON peptidase N-terminal domain and ring finger 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 584-773 of human LONRF1 (NP_689484.3).
Reactivity Human, Mouse, Rat
Gene ID 91694
Calculated MW 85kDa/86kDa
Observed MW 87kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LHVFEPRYRLMIRRSIQTGTKQFGMCVSDTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKVENEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQILQHFGSMPEREENLQAAPNGPAWCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQSK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents