LMX1B Polyclonal AntibodyLMX1B Polyclonal Antibody
Move your mouse over image or click to enlarge

LMX1B Polyclonal Antibody

Cat# Size Price Qty Buy
A14020-200ul 200ul
£332.50
A14020-100ul 100ul
£192.50
A14020-50ul 50ul
£113.75
A14020-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14020
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names LMX1B; LMX1.2; NPS1; LIM homeobox transcription factor 1-beta
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LMX1B (NP_001167618.1).
Reactivity Human, Mouse, Rat
Gene ID 4010
Calculated MW 44kDa/45kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MDIATGPESLERCFPRGQTDCAKMLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRK
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents