LILRA4 Polyclonal AntibodyLILRA4 Polyclonal Antibody
Move your mouse over image or click to enlarge

LILRA4 Polyclonal Antibody

Cat# Size Price Qty Buy
A3396-200ul 200ul
£332.50
A3396-100ul 100ul
£192.50
A3396-50ul 50ul
£113.75
A3396-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3396
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names LILRA4; CD85g; ILT7; leukocyte immunoglobulin like receptor A4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 240-450 of human LILRA4 (NP_036408.4).
Reactivity Human
Gene ID 23547
Calculated MW 47kDa/55kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LTLQCGSDVGYIRYTLYKEGADGLPQRPGRQPQAGLSQANFTLSPVSRSYGGQYRCYGAHNVSSEWSAPSDPLDILIAGQISDRPSLSVQPGPTVTSGEKVTLLCQSWDPMFTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSRSSNPYLLSHPSEPLELVVSGATETLNPAQKKSDSKTAPHLQDYTVENLIRM
Sensitivity WB,1:1000 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents