LILRA2 Polyclonal AntibodyLILRA2 Polyclonal Antibody
Move your mouse over image or click to enlarge

LILRA2 Polyclonal Antibody

Cat# Size Price Qty Buy
A4477-200ul 200ul
£332.50
A4477-100ul 100ul
£192.50
A4477-50ul 50ul
£113.75
A4477-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4477
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names LILRA2; CD85H; ILT1; LIR-7; LIR7; leukocyte immunoglobulin like receptor A2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-240 of human LILRA2 (NP_006857.2).
Reactivity Human
Gene ID 11027
Calculated MW 46kDa/48kDa/51kDa/52kDa
Observed MW 53kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESL
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents