LIG3 Polyclonal AntibodyLIG3 Polyclonal Antibody
Move your mouse over image or click to enlarge

LIG3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13507-200ul 200ul
£332.50
A13507-100ul 100ul
£192.50
A13507-50ul 50ul
£113.75
A13507-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13507
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names LIG3; LIG2; DNA ligase 3
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 730-1009 of human LIG3 (NP_039269.2).
Reactivity Human, Mouse, Rat
Gene ID 3980
Calculated MW 95kDa/102kDa/106kDa/112kDa
Observed MW 112kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AGGHDDATLARLQNELDMVKISKDPSKIPSWLKVNKIYYPDFIVPDPKKAAVWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTVVAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKDGNMQTAKPSAMKVGEKLATKSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPC
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents