LHX6 Polyclonal AntibodyLHX6 Polyclonal Antibody
Move your mouse over image or click to enlarge

LHX6 Polyclonal Antibody

Cat# Size Price Qty Buy
A13413-200ul 200ul
£332.50
A13413-100ul 100ul
£192.50
A13413-50ul 50ul
£113.75
A13413-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13413
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names LHX6; LHX6.1; LIM homeobox 6
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 143-392 of human LHX6 (NP_055183.2).
Reactivity Human
Gene ID 26468
Calculated MW 19kDa/38kDa/40kDa/41kDa/43kDa
Physical Appearance liquid
Purification Affinity purification
Sequence NKEIFCKMDYFSRFGTKCARCGRQIYASDWVRRARGNAYHLACFACFSCKRQLSTGEEFGLVEEKVLCRIHYDTMIENLKRAAENGNGLTLEGAVPSEQDSQPKPAKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents