LGR6 Polyclonal AntibodyLGR6 Polyclonal Antibody
Move your mouse over image or click to enlarge

LGR6 Polyclonal Antibody

Cat# Size Price Qty Buy
A14173-200ul 200ul
£332.50
A14173-100ul 100ul
£192.50
A14173-50ul 50ul
£113.75
A14173-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14173
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names LGR6; GPCR; VTS20631; leucine-rich repeat-containing G-protein coupled receptor 6
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 700-800 of human LGR6 (NP_001017404.1).
Reactivity Human, Rat
Gene ID 59352
Calculated MW 89kDa/99kDa/104kDa
Observed MW 98kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RRLRPRAGDSGPLAYAAAGELEKSSCDSTQALVAFSDVDLILEASEAGRPPGLETYGFPSVTLISCQQPGAPRLEGSHCVEPEGNHFGNPQPSMDGELLLR
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents