LARP1B Polyclonal AntibodyLARP1B Polyclonal Antibody
Move your mouse over image or click to enlarge

LARP1B Polyclonal Antibody

Cat# Size Price Qty Buy
A13222-200ul 200ul
£332.50
A13222-100ul 100ul
£192.50
A13222-50ul 50ul
£113.75
A13222-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13222
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names LARP1B; LARP2; la-related protein 1B
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 170-320 of human LARP1B (NP_060548.2).
Reactivity Human, Mouse
Gene ID 55132
Calculated MW 14kDa/24-38kDa/90-105kDa
Observed MW 105kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FDYSYGYQEHGERTDQPFQTELNTSMMYYYDDGTGVQVYPVEEALLKEYIKRQIEYYFSVENLERDFFLRGKMDEQGFLPISLIAGFQRVQALTTNLNLILEALKDSTEVEIVDEKMRKKIEPEKWPIPGPPPRSVPPTDFSQLIDCPEFV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents