KTN1 Polyclonal AntibodyKTN1 Polyclonal Antibody
Move your mouse over image or click to enlarge

KTN1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14016-200ul 200ul
£332.50
A14016-100ul 100ul
£192.50
A14016-50ul 50ul
£113.75
A14016-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14016
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KTN1; CG1; KNT; MU-RMS-40.19; kinectin
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-125 of human KTN1 (NP_001072989.1).
Reactivity Mouse
Gene ID 3895
Calculated MW 149kDa/150kDa/152kDa/156kDa
Observed MW 152kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FWLFMKETLYDEVLAKQKREQKLIPTKTDKKKAEKKKNKKKEIQNGNLHESDSESVPRDFKLSDALAVEDDQVAPVPLNVVETSSSVRERKKKEKKQKPVL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents