KRT81 Polyclonal AntibodyKRT81 Polyclonal Antibody
Move your mouse over image or click to enlarge

KRT81 Polyclonal Antibody

Cat# Size Price Qty Buy
A3940-200ul 200ul
£332.50
A3940-100ul 100ul
£192.50
A3940-50ul 50ul
£113.75
A3940-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3940
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KRT81; HB1; Hb-1; KRTHB1; MLN137; ghHkb1; hHAKB2-1; keratin 81
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 240-390 of human KRT81 (NP_002272.2).
Reactivity Human
Gene ID 3887
Calculated MW 54kDa
Observed MW 55kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RRLYEEEILILQSHISDTSVVVKLDNSRDLNMDCIIAEIKAQYDDIVTRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAVAQSEQQGEAALSDARCKLAELEGALQKAKQDMACLIREYQ
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents