KRT36 Polyclonal AntibodyKRT36 Polyclonal Antibody
Move your mouse over image or click to enlarge

KRT36 Polyclonal Antibody

Cat# Size Price Qty Buy
A13759-200ul 200ul
£332.50
A13759-100ul 100ul
£192.50
A13759-50ul 50ul
£113.75
A13759-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13759
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KRT36; HA6; KRTHA6; hHa6; keratin 36
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 388-467 of human KRT36 (NP_003762.1).
Reactivity Human
Gene ID 8689
Calculated MW 47kDa/52kDa
Observed MW 52kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GEIATYRHLLEGEDCKLPPQPCATACKPVIRVPSVPPVPCVPSVPCTPAPQVGTQIRTITEEIRDGKVISSREHVQSRPL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents