KRR1 Polyclonal AntibodyKRR1 Polyclonal Antibody
Move your mouse over image or click to enlarge

KRR1 Polyclonal Antibody

Cat# Size Price Qty Buy
A4487-200ul 200ul
£332.50
A4487-100ul 100ul
£192.50
A4487-50ul 50ul
£113.75
A4487-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4487
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KRR1; HRB2; RIP-1; KRR1 small subunit processome component homolog
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-381 of human KRR1 (NP_008974.5).
Reactivity Human, Mouse
Gene ID 11103
Calculated MW 36kDa/43kDa
Observed MW 44kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVVLDTMKNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFLKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEADEKKKKKKK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents