[KO Validated] PTPN1 Polyclonal Antibody[KO Validated] PTPN1 Polyclonal Antibody
Move your mouse over image or click to enlarge

[KO Validated] PTPN1 Polyclonal Antibody

Cat# Size Price Qty Buy
A1590-20ul 20ul
£112.00
A1590-50ul 50ul
£173.25
A1590-100ul 100ul
£287.00
A1590-200ul 200ul
£435.75

Additional Information

Property Value or Rating
Manufacturer Cat# A1590
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PTPN1; PTP1B; tyrosine-protein phosphatase non-receptor type 1
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 281-435 of human PTPN1 (NP_002818.1).
Reactivity Human, Mouse, Rat
Gene ID 5770
Calculated MW 49kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 26026874
Sequence IMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:10 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents