[KO Validated] N Cadherin Polyclonal Antibody[KO Validated] N Cadherin Polyclonal Antibody
Move your mouse over image or click to enlarge

[KO Validated] N Cadherin Polyclonal Antibody

Cat# Size Price Qty Buy
A3045-200ul 200ul
£435.75
A3045-100ul 100ul
£287.00
A3045-50ul 50ul
£173.25
A3045-20ul 20ul
£112.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3045
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CDH2; CD325; CDHN; CDw325; NCAD; cadherin-2
Applications IP, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 750-850 of human N Cadherin (NP_001783.2).
Reactivity Human, Mouse, Rat
Gene ID 1000
Calculated MW 97kDa/99kDa
Observed MW 135kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 29364502|29566977
Sequence DKERQAKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPDTVEPDAIKPVGIRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAP
Sensitivity WB,1:500 - 1:1000|IP,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents