KLK2 Polyclonal AntibodyKLK2 Polyclonal Antibody
Move your mouse over image or click to enlarge

KLK2 Polyclonal Antibody

Cat# Size Price Qty Buy
A2990-200ul 200ul
£332.50
A2990-100ul 100ul
£192.50
A2990-50ul 50ul
£113.75
A2990-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A2990
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KLK2; KLK2A2; hGK-1; hK2; kallikrein-2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-250 of human KLK2 (NP_005542.1).
Reactivity Human, Mouse
Gene ID 3817
Calculated MW 17kDa/18kDa/24kDa/28kDa
Observed MW 29kDa
Physical Appearance liquid
Purification Affinity purification
Sequence IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYR
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents