KLHL3 Polyclonal AntibodyKLHL3 Polyclonal Antibody
Move your mouse over image or click to enlarge

KLHL3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13771-200ul 200ul
£332.50
A13771-100ul 100ul
£192.50
A13771-50ul 50ul
£113.75
A13771-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13771
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KLHL3; PHA2D; kelch-like protein 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human KLHL3 (NP_059111.2).
Reactivity Human, Mouse
Gene ID 26249
Calculated MW 55kDa/61kDa/64kDa
Observed MW 75kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLCDVMIVAEDVEIEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents