KIRREL2 Polyclonal AntibodyKIRREL2 Polyclonal Antibody
Move your mouse over image or click to enlarge

KIRREL2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13130-200ul 200ul
£332.50
A13130-100ul 100ul
£192.50
A13130-50ul 50ul
£113.75
A13130-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13130
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KIRREL2; FILTRIN; NEPH3; NLG1; kin of IRRE-like protein 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-220 of human KIRREL2 (NP_954649.3).
Reactivity Human, Mouse, Rat
Gene ID 84063
Calculated MW 23kDa/61kDa/67kDa/75kDa
Observed MW 95kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GPSPHFLQQPEDLVVLLGEEARLPCALGAYWGLVQWTKSGLALGGQRDLPGWSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVLVPPEAPQVLGGPSVSLVAGVPANLTCRSRGDARPTPELLWFRDGVLLDGATFHQTLLKEGTPGSVESTLTLTPFSHDDGATFVCRARSQALPTGRDTAIT
Sensitivity WB,1:1000 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents