KIF5C Polyclonal AntibodyKIF5C Polyclonal Antibody
Move your mouse over image or click to enlarge

KIF5C Polyclonal Antibody

Cat# Size Price Qty Buy
A13801-200ul 200ul
£332.50
A13801-100ul 100ul
£192.50
A13801-50ul 50ul
£113.75
A13801-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13801
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KIF5C; CDCBM2; KINN; NKHC; NKHC-2; NKHC2; kinesin family member 5C
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 510-590 of human KIF5C (NP_004513.1).
Reactivity Human
Gene ID 3800
Calculated MW 83kDa/109kDa
Observed MW 109kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RANEQLTDELAQKTTTLTTTQRELSQLQELSNHQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLY
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents