KIAA0391 Polyclonal AntibodyKIAA0391 Polyclonal Antibody
Move your mouse over image or click to enlarge

KIAA0391 Polyclonal Antibody

Cat# Size Price Qty Buy
A14096-200ul 200ul
£332.50
A14096-100ul 100ul
£192.50
A14096-50ul 50ul
£113.75
A14096-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14096
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KIAA0391; MRPP3; PRORP
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 314-583 of human KIAA0391 (NP_055487.2).
Reactivity Human
Gene ID 9692
Calculated MW 24kDa/56kDa/65kDa/67kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence YPGESFAHSIKTWFESVPGKQWKGQFTTVRKSGQCSGCGKTIESIQLSPEEYECLKGKIMRDVIDGGDQYRKTTPQELKRFENFIKSRPPFDVVIDGLNVAKMFPKVRESQLLLNVVSQLAKRNLRLLVLGRKHMLRRSSQWSRDEMEEVQKQASCFFADDISEDDPFLLYATLHSGNHCRFITRDLMRDHKACLPDAKTQRLFFKWQQGHQLAIVNRFPGSKLTFQRILSYDTVVQTTGDSWHIPYDEDLVERCSCEVPTKWLCLHQKT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents