KDM2B Polyclonal AntibodyKDM2B Polyclonal Antibody
Move your mouse over image or click to enlarge

KDM2B Polyclonal Antibody

Cat# Size Price Qty Buy
A16017-20ul 20ul
£77.00
A16017-50ul 50ul
£113.75
A16017-100ul 100ul
£192.50
A16017-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16017
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KDM2B; CXXC2; FBXL10; Fbl10; JHDM1B; PCCX2; lysine demethylase 2B
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-700 of human KDM2B (XP_011537177.1).
Reactivity Human
Gene ID 84678
Calculated MW 63kDa/144kDa/149kDa/151kDa/152kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence SGCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQMDNRSKLRNIVELRLAGLDITDASLRLIIRHMPLLSKLHLSYCNHVTDQSIN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents