KCNK6 Polyclonal AntibodyKCNK6 Polyclonal Antibody
Move your mouse over image or click to enlarge

KCNK6 Polyclonal Antibody

Cat# Size Price Qty Buy
A16087-20ul 20ul
£77.00
A16087-50ul 50ul
£113.75
A16087-100ul 100ul
£192.50
A16087-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16087
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KCNK6; K2p6.1; KCNK8; TOSS; TWIK-2; TWIK2; potassium channel subfamily K member 6
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 254-313 of human KCNK6 (NP_004814.1).
Reactivity Human, Mouse, Rat
Gene ID 9424
Calculated MW 19kDa/33kDa
Observed MW 36kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QTFRHVSDLHGLTELILLPPPCPASFNADEDDRVDILGPQPESHQQLSASSHTDYASIPR
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents