KCNJ12 Polyclonal AntibodyKCNJ12 Polyclonal Antibody
Move your mouse over image or click to enlarge

KCNJ12 Polyclonal Antibody

Cat# Size Price Qty Buy
A14375-200ul 200ul
£332.50
A14375-100ul 100ul
£192.50
A14375-50ul 50ul
£113.75
A14375-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14375
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KCNJ12; IRK-2; IRK2; KCNJN1; Kir2.2; Kir2.2v; hIRK; hIRK1; hkir2.2x; kcnj12x; ATP-sensitive inward rectifier potassium channel 12
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 354-433 of human KCNJ12 (NP_066292.2).
Reactivity Mouse, Rat
Gene ID 3768
Calculated MW 49kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence TPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents