KCNH7 Polyclonal AntibodyKCNH7 Polyclonal Antibody
Move your mouse over image or click to enlarge

KCNH7 Polyclonal Antibody

Cat# Size Price Qty Buy
A15923-20ul 20ul
£77.00
A15923-50ul 50ul
£113.75
A15923-100ul 100ul
£192.50
A15923-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15923
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KCNH7; ERG3; HERG3; Kv11.3; potassium voltage-gated channel subfamily H member 7
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-350 of human KCNH7 (NP_775185.1).
Reactivity Mouse
Gene ID 90134
Calculated MW 82kDa/135kDa
Observed MW 135kDa
Physical Appearance liquid
Purification Affinity purification
Sequence HKNGSTFICNTHIIPVKNQEGVAMMFIINFEYVTDNENAATPERVNPILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPDVVVIDSSKHSDDSVAMKHFKSPTKESCSPSEADDTKALIQPSKCSPLVNISGPLDHSSPKRQWDRLYPDMLQSSSQLSHSRSRESLCSIRRASSVHDIEGFGVHPKNIFRDRHASEGPFNHIKSSLLGSTSDSNLNKYSTINKIPQLTLNFSEVKTEKKNSSPPSSDKT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents