KCNE2 Polyclonal AntibodyKCNE2 Polyclonal Antibody
Move your mouse over image or click to enlarge

KCNE2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14098-200ul 200ul
£332.50
A14098-100ul 100ul
£192.50
A14098-50ul 50ul
£113.75
A14098-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14098
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KCNE2; ATFB4; LQT5; LQT6; MIRP1; potassium voltage-gated channel subfamily E member 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-123 of human KCNE2 (NP_751951.1).
Reactivity Human, Mouse
Gene ID 9992
Calculated MW 14kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents