KAZN Polyclonal AntibodyKAZN Polyclonal Antibody
Move your mouse over image or click to enlarge

KAZN Polyclonal Antibody

Cat# Size Price Qty Buy
A16028-20ul 20ul
£77.00
A16028-50ul 50ul
£113.75
A16028-100ul 100ul
£192.50
A16028-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16028
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KAZN; KAZ; kazrin
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 586-775 of human KAZN (NP_963922.2).
Reactivity Human
Gene ID 23254
Calculated MW 37kDa/46kDa/86kDa
Observed MW 86kDa
Physical Appearance liquid
Purification Affinity purification
Sequence YQVNFSREALQERRARCETQNIDPVVWTNQRVLKWVRDIDLKEYADNLTNSGVHGAVLVLEPTFNAEAMATALGIPSGKHILRRHLAEEMSAVFHPANSTGIREAERFGTPPGRASSVTRAGKEENSSGLKYKAGRLPLGKIGRGFSSKDPDFHDDYGSLQNEDCGDDDPQSRLEQCRLEGYNSLEVTNV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents