JNK1 Polyclonal AntibodyJNK1 Polyclonal Antibody
Move your mouse over image or click to enlarge

JNK1 Polyclonal Antibody

Cat# Size Price Qty Buy
A2985-200ul 200ul
£332.50
A2985-100ul 100ul
£192.50
A2985-50ul 50ul
£113.75
A2985-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A2985
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MAPK8; JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c; mitogen-activated protein kinase 8
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 245-345 of human JNK1 (NP_620635.1).
Reactivity Human
Gene ID 5599
Calculated MW 35kDa/44kDa/48kDa
Physical Appearance liquid
Purification Affinity purification
Sequence CPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDER
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents