ITGA7 Polyclonal AntibodyITGA7 Polyclonal Antibody
Move your mouse over image or click to enlarge

ITGA7 Polyclonal Antibody

Cat# Size Price Qty Buy
A14246-200ul 200ul
£332.50
A14246-100ul 100ul
£192.50
A14246-50ul 50ul
£113.75
A14246-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14246
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ITGA7; integrin alpha-7
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 880-1020 of human ITGA7 (NP_002197.2).
Reactivity Human
Gene ID 3679
Calculated MW 114kDa/121kDa/124kDa/126kDa/128kDa
Observed MW 140kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QVELEGGQGPGQKGLCSPRPNILHLDVDSRDRRRRELEPPEQQEPGERQEPSMSWWPVSSAEKKKNITLDCARGTANCVVFSCPLYSFDRAAVLHVWGRLWNSTFLEEYSAVKSLEVIVRANITVKSSIKNLMLRDASTVI
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents