ITGA6 Polyclonal AntibodyITGA6 Polyclonal Antibody
Move your mouse over image or click to enlarge

ITGA6 Polyclonal Antibody

Cat# Size Price Qty Buy
A3236-200ul 200ul
£332.50
A3236-100ul 100ul
£192.50
A3236-50ul 50ul
£113.75
A3236-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3236
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ITGA6; CD49f; ITGA6B; VLA-6; integrin alpha-6
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 870-1010 of human ITGA6 (NP_001073286.1).
Reactivity Human
Gene ID 3655
Calculated MW 106kDa/119kDa/121kDa/122kDa/124kDa/126kDa
Observed MW 105kDa
Physical Appearance liquid
Purification Affinity purification
Sequence KVESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNSTFLEEYSKLNYLDILMRAFIDVTAAAENIRLPNAGTQVRVTVFPSKTVAQY
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents