ITGA1 Polyclonal AntibodyITGA1 Polyclonal Antibody
Move your mouse over image or click to enlarge

ITGA1 Polyclonal Antibody

Cat# Size Price Qty Buy
A16054-20ul 20ul
£77.00
A16054-50ul 50ul
£113.75
A16054-100ul 100ul
£192.50
A16054-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16054
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ITGA1; CD49a; VLA1; integrin alpha-1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 700-800 of human ITGA1 (NP_852478.1).
Reactivity Mouse, Rat
Gene ID 3672
Calculated MW 130kDa
Observed MW 200kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ATVCFDVKLKSKEDTIYEADLQYRVTLDSLRQISRSFFSGTQERKVQRNITVRKSECTKHSFYMLDKHDFQDSVRITLDFNLTDPENGPVLDDSLPNSVHE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents