ITFG1 Polyclonal AntibodyITFG1 Polyclonal Antibody
Move your mouse over image or click to enlarge

ITFG1 Polyclonal Antibody

Cat# Size Price Qty Buy
A15901-20ul 20ul
£77.00
A15901-50ul 50ul
£113.75
A15901-100ul 100ul
£192.50
A15901-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15901
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ITFG1; 2310047C21Rik; CDA08; LNKN-1; TIP; T-cell immunomodulatory protein
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 313-612 of human ITFG1 (NP_110417.2).
Reactivity Human, Mouse, Rat
Gene ID 81533
Calculated MW 68kDa
Observed MW 80kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LWGFVPFVDEQQPTEIPIPITLHIGDYNMDGYPDALVILKNTSGSNQQAFLLENVPCNNASCEEARRMFKVYWELTDLNQIKDAMVATFFDIYEDGILDIVVLSKGYTKNDFAIHTLKNNFEADAYFVKVIVLSGLCSNDCPRKITPFGVNQPGPYIMYTTVDANGYLKNGSAGQLSQSAHLALQLPYNVLGLGRSANFLDHLYVGIPRPSGEKSIRKQEWTAIIPNSQLIVIPYPHNVPRSWSAKLYLTPSNIVLLTAIALIGVCVFILAIIGILHWQEKKADDREKRQEAHRFHFDAM
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents