IQWD1 Polyclonal AntibodyIQWD1 Polyclonal Antibody
Move your mouse over image or click to enlarge

IQWD1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14286-200ul 200ul
£332.50
A14286-100ul 100ul
£192.50
A14286-50ul 50ul
£113.75
A14286-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14286
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DCAF6; 1200006M05Rik; ARCAP; IQWD1; MSTP055; NRIP; PC326; DDB1 and CUL4 associated factor 6
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 460-650 of human IQWD1 (NP_001017977.1).
Reactivity Human
Gene ID 55827
Calculated MW 96kDa/98kDa/103kDa/106kDa
Observed MW 105kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DNNNEKLSPKPGTGEPVLSLHYSTEGTTTSTIKLNFTDEWSSIASSSRGIGSHCKSEGQEESFVPQSSVQPPEGDSETKAPEESSEDVTKYQEGVSAENPVENHINITQSDKFTAKPLDSNSGERNDLNLDRSCGVPEESASSEKAKEPETSDQTSTESATNENNTNPEPQFQTEATGPSAHEETSTRDSA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents