IQGAP3 Polyclonal AntibodyIQGAP3 Polyclonal Antibody
Move your mouse over image or click to enlarge

IQGAP3 Polyclonal Antibody

Cat# Size Price Qty Buy
A14197-200ul 200ul
£332.50
A14197-100ul 100ul
£192.50
A14197-50ul 50ul
£113.75
A14197-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14197
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IQGAP3; ras GTPase-activating-like protein IQGAP3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1437-1631 of human IQGAP3 (NP_839943.2).
Reactivity Human, Mouse, Rat
Gene ID 128239
Calculated MW 184kDa
Observed MW 170kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QRRVLRNLRRLEALGLVSARNGYQGLVDELAKDIRNQHRHRHRRKAELVKLQATLQGLSTKTTFYEEQGDYYSQYIRACLDHLAPDSKSSGKGKKQPSLHYTAAQLLEKGVLVEIEDLPASHFRNVIFDITPGDEAGKFEVNAKFLGVDMERFQLHYQDLLQLQYEGVAVMKLFNKAKVNVNLLIFLLNKKFLRK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents