IP6K2 Polyclonal AntibodyIP6K2 Polyclonal Antibody
Move your mouse over image or click to enlarge

IP6K2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13427-200ul 200ul
£332.50
A13427-100ul 100ul
£192.50
A13427-50ul 50ul
£113.75
A13427-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13427
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IP6K2; IHPK2; PIUS; inositol hexakisphosphate kinase 2
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human IP6K2 (NP_057375.2).
Reactivity Human
Gene ID 51447
Calculated MW 8kDa/9kDa/11kDa/20kDa/21kDa/49kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVVSVRFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEKMKSHKLEEEFEWLKKSEVLYYTVEKKGNISSQLKHYNPWS
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents