INPP5B Polyclonal AntibodyINPP5B Polyclonal Antibody
Move your mouse over image or click to enlarge

INPP5B Polyclonal Antibody

Cat# Size Price Qty Buy
A3927-200ul 200ul
£332.50
A3927-100ul 100ul
£192.50
A3927-50ul 50ul
£113.75
A3927-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3927
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names INPP5B; 5PTase; inositol polyphosphate-5-phosphatase B
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human INPP5B (NP_005531.2).
Reactivity Human, Mouse, Rat
Gene ID 3633
Calculated MW 85kDa/93kDa/103kDa/112kDa
Observed MW 113kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MDQSVAIQETLAEGEYCVIAVQGVLCEGDSRQSRLLGLVRYRLEHGGQEHALFLYTHRRMAITGDDVSLDQIVPVSRDFTLEEVSPDGELYILGSDVTVQLDTAELSLVFQLPFGSQTRMFLHEVARACPGFDSATRDPEFLWLSRYRCAELELEMPTPRGCNSALVTWPGYATIGGGGSNFDGLRPNGKGVPMDQSSRGQDKPESLQPRQNKSKSEITDMVRSSTITVSDKAHILSMQKFGLRDTIVKSHLLQKEEDYT
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents